FAM69A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FAM69A, Each
$ 1,069.20
|
|
Details:
This gene may encode a transmembrane protein. Transcript variants of this gene may exist, but their full-length natures have not been determined. [provided by RefSeqSequence: GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQPNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNL
Additional Information
| SKU | 10287114 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20838 |
