FAM69A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FAM69A, Each

$ 1,069.20
|
Details
This gene may encode a transmembrane protein. Transcript variants of this gene may exist, but their full-length natures have not been determined. [provided by RefSeqSequence: GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQPNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNL
Additional Information
SKU | 10287114 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB20838 |