518-831-8000 sales@utechproducts.com

FBLN2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FBLN2, Each

1,069.20

Details:

This gene encodes an extracellular matrix protein, which belongs to the fibulin family. This protein binds various extracellular ligands and calcium. It may play a role during organ development, in particular, during the differentiation of heart, skeletal and neuronal structures. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeqSequence: TLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDGTKCVDVNE

Additional Information

SKU 10292391
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28537