518-831-8000 sales@utechproducts.com

Fbxl16 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fbxl16, Each

$ 1,757.70

Details

Members of the f-box protein family, such as fbxl16, are characterized by an approximately 40-amino acid f-box motif. Scf complexes, formed by skp1 (mim 601434), cullin (see cul1; mim 603134), and f-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with skp1 through the f box, and they interact with ubiquitination targets through other protein interaction domains (jin et al., 2004 [Pubmed 15520277]).[Supplied by omim]sequence: ilnglfwyfsacekcvlaqvckawrrvlyqpkfwagltpvlhakelynvlpggekefvnlqgfaargfegfclvgvsdldicefidnyalskkgvka

Additional Information

SKU 10289464
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23555