518-831-8000 sales@utechproducts.com

Flad1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Flad1, Each

$ 1,757.70

Details

This gene encodes the enzyme that catalyzes adenylation of flavin mononucleotide (fmn) to form flavin adenine dinucleotide (fad) coenzyme. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [Provided by refseqsequence: rtdpyscslcpfsptdpgwpafmrinplldwtyrdiwdflrqlfvpycilydrgytslgsrentvrnpalkclspgghptyrpayllenee

Additional Information

SKU 10288284
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22183