518-831-8000 sales@utechproducts.com

Flii Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Flii, Each

$ 1,757.70

Details

This gene encodes a protein with a gelsolin-like actin binding domain and an n-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the smith-magenis syndrome region on chromosome 17. [Provided by refseqsequence: kdsaqddqakqvlkgmsdvaqeknkkqeesadarapsgkvrrwdqglekprldysefftedvgqlpgltiwqienfvpvlveeafhgkfyeadcyivlktflddsgslnweiyywiggeatldkkacsai

Additional Information

SKU 10286696
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20358