FMNL3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FMNL3, Each
$ 1,069.20
|
|
Details
The protein encoded by this gene contains a formin homology 2 domain and has high sequence identity to the mouse Wbp3 protein. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeqSequence: LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
Additional Information
| SKU | 10292432 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28587 |
Loading Cart Data 