518-831-8000 sales@utechproducts.com

Gabbr2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gabbr2, Each

$ 1,757.70

Details

B-type receptors for the neurotransmitter gaba (gamma-aminobutyric acid) inhibit neuronal activity through g protein-coupled second-messenger systems, which regulate the release of neurotransmitters and the activity of ion channels and adenylyl cyclase. See gabbr1 (mim 603540) for additional background information on gaba-b receptors.[Supplied by omimsequence: sktstsvtsvnqastsrleglqsenhrlrmkiteldkdleevtmqlqdtpekttyikqnhyqelndilnlgnftestdggkailknhldqnpqlqwnttepsrtckdpiedinspehiqrrlslqlpi

Additional Information

SKU 10286974
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20675