518-831-8000 sales@utechproducts.com

Gbp3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gbp3, Each

$ 1,757.70

Details

This gene encodes a member of the guanylate-binding protein (gbp) family. Gbps specifically bind guanine nucleotides (gmp, gdp, and gtp) and contain two of the three consensus motifs found in typical gtp-binding proteins. The encoded protein interacts with a member of the germinal center kinase family. [Provided by refseqsequence: lleeqektltsklqeqarvlkercqgestqlqneiqklqktlkkktkrymshk

Additional Information

SKU 10290112
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24438