518-831-8000 sales@utechproducts.com

Gcet2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gcet2, Each

$ 1,757.70

Details

This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative pdz-interacting domain, an immunoreceptor tyrosine-based activation motif (itam), and two putative sh2 binding sites. In b cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [Provided by refseqsequence: hiaegcfclpwkkilifekrqdsqnenermsstpiqdnvdqtyseelcytlinhrvlctrpsgnsaeeyyenvpckaerpreslggteteysllhmpstdprharspedeyellmphrisshfl

Additional Information

SKU 10292508
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28669