518-831-8000 sales@utechproducts.com

GFRA3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GFRA3, Each

1,757.70

Details:

The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin. [provided by RefSeqSequence: LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL

Additional Information

SKU 10287536
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21328