518-831-8000 sales@utechproducts.com

Ggct Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ggct, Each

$ 1,757.70

Details

Ggct (ec 2.3.2.4) Catalyzes the formation of 5-oxoproline (pyroglutamic acid) from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis (oakley et al., 2008 [Pubmed 18515354]).[Supplied by omimsequence: nsgckdvtgpdeesflyfaygsnllterihlrnpsaaffcvarlqdfkldfgnsqgktsqtwhggiatifqspgdevwgvvwkmnksnlnslde

Additional Information

SKU 10288442
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22369