518-831-8000 sales@utechproducts.com

GIMAP1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GIMAP1, Each

1,069.20

Details:

This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeqSequence: VCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQ

Additional Information

SKU 10290051
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24369