GJC3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GJC3, Each
$ 1,069.20
|
|
Details:
Connexins, such as GJC3, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIMSequence: RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Additional Information
| SKU | 10287066 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20786 |
Loading Cart Data 