518-831-8000 sales@utechproducts.com

Gldc, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gldc, Each

$ 1,757.70

Details

The enzyme system for cleavage of glycine (glycine cleavage system; gcs; ec 2.1.2.10), Which is confined to the mitochondria, is composed of 4 protein components: p protein (a pyridoxal phosphate-dependent glycine decarboxylase), h protein (a lipoic acid-containing protein), t protein (a tetrahydrofolate-requiring enzyme), and l protein (a lipoamide dehydrogenase). Glycine encephalopathy (gce; mim 605899) may be due to a defect in any one of these enzymes; see mim 238310, mim 238330, and mim 238331.[Supplied by omimsequence: ilnanymakrlethyrilfrgargyvghefildtrpfkksanieavdvakrlqdygfhaptmswpvagtlmveptesedkaeldrfcdamisirqeiadieegridprvnplkmsphsltcvtsshwdrpysrevaafplpfvkpenk

Additional Information

SKU 10287325
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21084