518-831-8000 sales@utechproducts.com

GOLGA4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GOLGA4, Each

1,069.20

Details:

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The golgins are a family of proteins, of which the protein encoded by this gene is a member, that are localized to the Golgi. This protein has been postulated to play a role in Rab6-regulated membrane-tethering events in the Golgi apparatus. Alternative splice variants have been described but their full-length nature has not been determined. [provided by RefSeqSequence: NLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAE

Additional Information

SKU 10288700
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22660