HDLBP Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HDLBP, Each
$ 1,757.70
|
|
Details:
High density lipoprotein-binding protein, also known as vigilin, is a 110kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.[supplied by OMIMSequence: DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE
Additional Information
| SKU | 10286624 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20269 |
