518-831-8000 sales@utechproducts.com

HIVEP3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HIVEP3, Each

1,069.20

Details:

Members of the ZAS family, such as ZAS3 (HIVEP3), are large proteins that contain a ZAS domain, a modular protein structure consisting of a pair of C2H2 zinc fingers with an acidic-rich region and a serine/threonine -rich sequence. These proteins bind specific DNA sequences, including the kappa-B motif (GGGACTTTCC), in the promoters and enhancer regions of several genes and viruses, including human immunodeficiency virus (HIV). ZAS genes span more than 150kb and contain at least 10 exons, one of which is longer than 5.5kb (Allen and Wu, 2004).[supplied by OMIMSequence: SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL

Additional Information

SKU 10288066
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21918