518-831-8000 sales@utechproducts.com

Hs3st1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hs3st1, Each

$ 1,757.70

Details

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-o-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal golgi resident protein. [Provided by refseqsequence: tqvfynhmqkhkpypsieeflvrdgrlnvdykalnrslyhvhmqnwlrffplrhihivdgdrlirdpfpeiqkverflklspqinasnfyfnktkgfyclrdsgrdrclheskgrahpqvdpkllnklheyfhepnkkffelvgr

Additional Information

SKU 10292426
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28581