518-831-8000 sales@utechproducts.com

HSPA12B Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HSPA12B, Each

1,757.70

Details:

The protein encoded by this gene contains an atypical heat shock protein 70 (Hsp70) ATPase domain and is therefore a distant member of the mammalian Hsp70 family. This gene may be involved in susceptibility to atherosclerosis. [provided by RefSeqSequence: LAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTTSSGYAFSFASDPEAIHMMRKWEGG

Additional Information

SKU 10287108
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20831