IDH3G, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant IDH3G, Each

Details

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD( ) as the electron acceptor and the other NADP( ). Five isocitrate dehydrogenases have been reported: three NAD( )-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP( )-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD( )-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD( )-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined. [provided by RefSeqSequence: ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA