518-831-8000 sales@utechproducts.com

Ifih1, Domain 1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ifih1, Domain 1, Each

$ 1,757.70

Details

Dead box proteins, characterized by the conserved motif asp-glu-ala-asp (dead), are putative rna helicases. They are implicated in a number of cellular processes involving alteration of rna secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a dead box protein that is upregulated in response to treatment with beta-interferon (ifnb) and a protein kinase c-activating compound, mezerein (mez). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. [Provided by refseqsequence: tirmidaythletfyneekdkkfavieddsdeggddeycdgdededdlkkplkldetdrflmtlffennkmlkrlaenpeyenekltklrntimeqytrteesargiiftktrqsayalsqwitenekfaevgvkahhligaghssefkp

Additional Information

SKU 10292517
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28678