518-831-8000 sales@utechproducts.com

Ifngr2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ifngr2, Each

$ 1,757.70

Details

This gene (ifngr2) encodes the nonligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of ifngr1 and ifngr2. Defects in ifngr2 are a cause of mendelian susceptibility to mycobacterial disease (msmd), also known as familial disseminated atypical mycobacterial infection. Msmd is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or x-linked inheritance. [Provided by refseqsequence: aspsagfpmdfnvtlrlraelgalhsawvtmpwfqhyrnvtvgppenievtpgegsliirfsspfdiadtstaffcyyvhywekggiqqvkgpfrsnsisldnlkpsrvyclqvqaqllwnksnifrvghlsnis

Additional Information

SKU 10292271
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28384