518-831-8000 sales@utechproducts.com

Igf2bp1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Igf2bp1, Each

$ 1,757.70

Details

This gene encodes a member of the insulin-like growth factor 2 mrna-binding protein family. The protein encoded by this gene contains four k homology domains and two rna recognition motifs. It functions by binding to the mrnas of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: dvaamslqshlipglnlaavglfpasssavppppssvtgaapyssfmqapeqemvqvfipaqavgaiigkk

Additional Information

SKU 10287598
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21395