518-831-8000 sales@utechproducts.com

IGSF11, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant IGSF11, Each

1,347.30

Details:

IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).[supplied by OMIMSequence: PPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKP

Additional Information

SKU 10290170
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24502