IL17RE Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant IL17RE, Each
$ 1,757.70
|
|
Details:
This gene encodes a protein that shares limited similarity with the interleukin-17 receptor. The function of the encoded protein has not yet been determined. Three alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported. [provided by RefSeqSequence: EKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCMEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYS
Additional Information
| SKU | 10287296 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21053 |
