INSL5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant INSL5, Each
$ 1,069.20
|
|
Details:
The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeqSequence: LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR
Additional Information
| SKU | 10288456 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22388 |
