KCNK1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KCNK1, Each
$ 1,069.20
|
|
Details:
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other nonpore-forming proteins for activity. [provided by RefSeqSequence: YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
Additional Information
| SKU | 10287140 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20865 |
