518-831-8000 sales@utechproducts.com

KIF18A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KIF18A, Each

1,757.70

Details:

KIF18A is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that use hydrolysis of ATP to produce force and movement along microtubules (Luboshits and Benayahu, 2005 [PubMed 15878648]).[supplied by OMIMSequence: AFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTFTICEDIKSSKCKLPEQESLPNDNKDILQRLDP

Additional Information

SKU 10289459
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23550