KIF5A Rabbit anti-Human, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KIF5A, Each

$ 1,069.20
|
Details
This gene encodes a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10. [provided by RefSeqSequence: AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ
Additional Information
SKU | 10286626 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB20271 |