518-831-8000 sales@utechproducts.com

KIF5A Rabbit anti-Human, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KIF5A, Each

1,757.70

Details:

This gene encodes a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10. [provided by RefSeqSequence: AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ

Additional Information

SKU 10286626
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20271