LACTB Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LACTB, Each

$ 1,069.20
|
Details
This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins. [provided by RefSeqSequence: NSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVEKKQTYGSCRKQRHYASHTGGAVGASSVLLVLPEELDTETINNKVP
Additional Information
SKU | 10288972 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22989 |