518-831-8000 sales@utechproducts.com

Leo1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Leo1, Each

$ 1,757.70

Details

Leo1, parafibromin (cdc73; mim 607393), ctr9 (mim 609366), and paf1 (mim 610506) form the paf protein complex that associates with the rna polymerase ii subunit polr2a (mim 180660) and with a histone methyltransferase complex (rozenblatt-rosen et al., 2005 [Pubmed 15632063]).[Supplied by omimsequence: sgqpsnkelfgddsedegashhsgsdnhsersdnrseasersdhedndpsdvdqhsgseapnddedeghrsdggshhseaegsekahsddekwgredksdqsddekiqnsd

Additional Information

SKU 10289583
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23688