LEO1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LEO1, Each

$ 1,069.20
|
Details
LEO1, parafibromin (CDC73; MIM 607393), CTR9 (MIM 609366), and PAF1 (MIM 610506) form the PAF protein complex that associates with the RNA polymerase II subunit POLR2A (MIM 180660) and with a histone methyltransferase complex (Rozenblatt-Rosen et al., 2005 [PubMed 15632063]).[supplied by OMIMSequence: DEERAQGSDEDKLQNSDDDEKMQNTGDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEGQPQLSDEEKMQNSDDER
Additional Information
SKU | 10289614 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23722 |