518-831-8000 sales@utechproducts.com

LHFPL1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LHFPL1, Each

1,757.70

Details:

This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeqSequence: GKPVSFSTFRRCNYPVRGEGHSLIMVEECGRYASFNAIPSLAWQMCT

Additional Information

SKU 10286519
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20154