518-831-8000 sales@utechproducts.com

Lilrb5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lilrb5, Each

$ 1,757.70

Details

This gene is a member of the leukocyte immunoglobulin-like receptor (lir) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily b class of lir receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (itims). Several other lir subfamily b receptors are expressed on immune cells where they bind to mhc class i molecules on antigen-presenting cells and inhibit stimulation of an immune response. Multiple transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: pkptlwaepasviargkpvtlwcqgpleteeyrldkeglpwarkrqnplepgakakfhipstvydsagryrcyyetpagwsepsdplelvatg

Additional Information

SKU 10286898
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20582