LINS1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LINS1, Each
$ 1,757.70
|
|
Details:
The Drosophila segment polarity gene lin encodes a protein, lines, which plays important roles in development of the epidermis and hindgut. This gene encodes a protein containing a lines-like domain. This gene is located on chromosome 15 and clustered with the gene encoding ankyrin repeat and SOCS box-containing protein 7. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeqSequence: SRVFIEQDDDMLEAAKASLGIYLTLTRGCEATESLTQGKEMWDHHTHENGYNPHCIFLFFLKNIGFDSTVLLDFLISSETCFLEYFVRYLKLLQKDWDN
Additional Information
| SKU | 10289246 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23308 |
