LOC203547, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LOC203547, Each
$ 1,757.70
|
|
Details:
This gene encodes a vacuolar ATPase assembly integral membrane protein. Mutations of this gene result in an X-linked vacuolar myopathy with excessive autophagySequence: PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRTPRSHRR
Additional Information
| SKU | 10286841 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20520 |
