518-831-8000 sales@utechproducts.com

LRPPRC, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LRPPRC, Each

1,069.20

Details:

This gene encodes a protein that is leucine-rich and is thought to play a role in regulating the interaction of the cytoskeleton with a variety of cellular processes. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome. Transcripts ranging in size from 4.8 to 7.0kb which result from alternative polyadenylation have been reported for this gene. [provided by RefSeqSequence: RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT

Additional Information

SKU 10288979
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22998