LRPPRC, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LRPPRC, Each
$ 1,069.20
|
|
Details:
This gene encodes a protein that is leucine-rich and is thought to play a role in regulating the interaction of the cytoskeleton with a variety of cellular processes. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome. Transcripts ranging in size from 4.8 to 7.0kb which result from alternative polyadenylation have been reported for this gene. [provided by RefSeqSequence: RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT
Additional Information
| SKU | 10288979 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22998 |
