518-831-8000 sales@utechproducts.com

LUZP1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LUZP1, Each

1,757.70

Details:

This gene encodes a protein that contains a leucine zipper motif. The exact function of the encoded protein is not known. In mice this gene affects neural tube closure. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: RERHTSTSNIQVGLAELTSVSNHVSSPFELSIHKHDITLQLAEAERMADGPLKNRPETVVSRSSIIIKPSDPVERNSHAPPAETIRWKSH

Additional Information

SKU 10288271
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22169