518-831-8000 sales@utechproducts.com

Map1b, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Map1b, Each

$ 1,757.70

Details

This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The product of this gene is a precursor polypeptide that presumably undergoes proteolytic processing to generate the final map1b heavy chain and lc1 light chain. Gene knockout studies of the mouse microtubule-associated protein 1b gene suggested an important role in development and function of the nervous system. [Provided by refseqsequence: evveehcaspedktlevvspsqsvtgsaghtpyyqsptdeksshlpteviekppavpvsfefsdakdenerasvspmdepvpdsespiekvlsplrsppligsesayesflsaddkasgrgaespfeeksgkqgspdqvspvsemtst

Additional Information

SKU 10287678
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21488