MCOLN3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MCOLN3, Each
$ 1,069.20
|
|
Details
Mucolipins constitute a family of cation channel proteins with homologs in mouse, Drosophila, and C. elegans. Mutations in the human MCOLN1 gene (MIM 605248) cause mucolipodosis IV (MIM 262650).[supplied by OMIMSequence: YENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLT
Additional Information
| SKU | 10287259 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21014 |
Loading Cart Data 