518-831-8000 sales@utechproducts.com

MED15, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MED15, Each

1,069.20

Details:

The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP

Additional Information

SKU 10292544
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28707