518-831-8000 sales@utechproducts.com

MLLT4 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MLLT4, Each

1,069.20

Details:

AF6 is a Ras (see HRAS; MIM 190020) target that regulates cell-cell adhesions downstream of Ras activation. It is fused with MLL (MIM 159555) in leukemias caused by t(6;11) translocations (Taya et al., 1998 [PubMed 9722616]).[supplied by OMIMSequence: ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD

Additional Information

SKU 10288481
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22417