MLLT4 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MLLT4, Each
$ 1,069.20
|
|
Details:
AF6 is a Ras (see HRAS; MIM 190020) target that regulates cell-cell adhesions downstream of Ras activation. It is fused with MLL (MIM 159555) in leukemias caused by t(6;11) translocations (Taya et al., 1998 [PubMed 9722616]).[supplied by OMIMSequence: KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ
Additional Information
| SKU | 10288482 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22418 |
