518-831-8000 sales@utechproducts.com

Mllt4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mllt4, Each

$ 1,757.70

Details

Af6 is a ras (see hras; mim 190020) target that regulates cell-cell adhesions downstream of ras activation. It is fused with mll (mim 159555) in leukemias caused by t(6;11) translocations (taya et al., 1998 [Pubmed 9722616]).[Supplied by omimsequence: kpekpstlqrpqetvirelqpqqqprtierrdlqyitvskeelssgdslspdpwkrdakeklekqqqmhivdmlskeiqelqskpdrsaeesdrlrklmlewq

Additional Information

SKU 10288482
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22418