518-831-8000 sales@utechproducts.com

MPDU1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MPDU1, Each

1,757.70

Details:

This gene encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-P-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type If. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK

Additional Information

SKU 10287056
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20774