518-831-8000 sales@utechproducts.com

Nae1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nae1, Each

$ 1,757.70

Details

The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of alzheimer's disease. In addition, the encoded protein can form a heterodimer with ube1c and bind and activate nedd8, a ubiquitin-like protein. This protein is required for cell cycle progression through the s/m checkpoint. Three transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: psfwilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkde

Additional Information

SKU 10291941
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27899