NARG1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NARG1, Each
$ 1,757.70
|
|
Details:
This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. [provided by RefSeqSequence: ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG
Additional Information
| SKU | 10287773 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21591 |
