518-831-8000 sales@utechproducts.com

Nefm Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nefm, Each

$ 1,757.70

Details

Neurofilaments are type iv intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and functionally maintain neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the medium neurofilament protein. This protein is commonly used as a biomarker of neuronal damage. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [Provided by refseqsequence: yiekvhyleqqnkeieaeiqalrqkqashaqlgdaydqeirelratlemvnhekaqvqldsdhleedihrlkerfeeearlrddteaairalrkdieeaslvkveldkkvqslqdevaflrsnh

Additional Information

SKU 10287725
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21539