518-831-8000 sales@utechproducts.com

Nfkbiz Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nfkbiz, Each

$ 1,757.70

Details

This gene is a member of the ankyrin-repeat family and is induced by lipopolysaccharide (lps). The c-terminal portion of the encoded product which contains the ankyrin repeats, shares high sequence similarity with the i kappa b family of proteins. The latter are known to play a role in inflammatory responses to lps by their interaction with nf-b proteins through ankyrin-repeat domains. Studies in mouse indicate that this gene product is one of the nuclear i kappa b proteins and an activator of il-6 production. Two transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: qgrralsyvlarkmnalhmldikehngqsafqvavaanqhlivqdlvnigaqvnttdcwgrtplhvcaekghsqvlqaiqkgavgsnqfvdleatnydgltplhcaviahnavvhelqrnqqphspevqelll

Additional Information

SKU 10286824
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20499