518-831-8000 sales@utechproducts.com

Nkain4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nkain4, Each

$ 1,757.70

Details

Nkain4 is a member of a family of mammalian proteins (see nkain1; mim 612871) with similarity to drosophila nkain and interacts with the beta subunit of na,k-atpase (atp1b1; mim 182330) (gorokhova et al., 2007 [Pubmed 17606467]).[Supplied by omimsequence: lkdselltfslsrhrswwrerwpgclheevpavglgaphgqalvsgagcalepsyvealhsclqiliallgfvcgcqvvsvfteeedsfdfiggfdpfplyhvnekpssllskqvy

Additional Information

SKU 10288435
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22361