NKAP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NKAP, Each

$ 1,065.15
|
Details
NKAP is a transcriptional repressor that associates with the NOTCH (see MIM 190198) corepressor complex and is required for T-cell development (Pajerowski et al., 2009 [PubMed 19409814]).[supplied by OMIMSequence: RRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLS
Additional Information
SKU | 10286393 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB20018 |